Proteintech, 17159-1-AP, N4BP2L2 Polyclonal antibody

Size: 20ul / 150ul The N4BP2L2 (17159-1-AP) by Proteintech is a Polyclonal antibody targeting N4BP2L2 in WB, ELISA applications with reactivity to human samples 17159-1-AP targets N4BP2L2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10448 Product name: Recombinant human N4BP2L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 234-583 aa of BC010643 Sequence: DYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRYVSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNIQAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMSISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH Predict reactive species Full Name: NEDD4 binding protein 2-like 2 Calculated Molecular Weight: 583 aa, 67 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC010643 Gene Symbol: N4BP2L2 Gene ID (NCBI): 10443 RRID: AB_3669263 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92802 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.