Iright
BRAND / VENDOR: Proteintech

Proteintech, 17163-1-AP, OATP14 Polyclonal antibody

CATALOG NUMBER: 17163-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OATP14 (17163-1-AP) by Proteintech is a Polyclonal antibody targeting OATP14 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17163-1-AP targets OATP14 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse brain tissue, mouse kidney tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10573 Product name: Recombinant human OATP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-391 aa of BC022461 Sequence: VPFWYLPKSLPRSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLCTSTVQFNSLFGMVTYKPKYIEQQYGQSSSRA Predict reactive species Full Name: solute carrier organic anion transporter family, member 1C1 Calculated Molecular Weight: 712 aa, 79 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: BC022461 Gene Symbol: SLCO1C1 Gene ID (NCBI): 53919 RRID: AB_2189706 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924