Proteintech, 17191-1-AP, DNMBP Polyclonal antibody

Size: 20ul / 150ul The DNMBP (17191-1-AP) by Proteintech is a Polyclonal antibody targeting DNMBP in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17191-1-AP targets DNMBP in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10973 Product name: Recombinant human DNMBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 473-824 aa of BC041628 Sequence: RVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQDASPPPKEWDQGTLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVARDVKQPTATPRSYRNFRHPEIVGYSVPGRNGQSQDLVKGCARTAQAPEDRSTEPDGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT Predict reactive species Full Name: dynamin binding protein Calculated Molecular Weight: 823aa,94 kDa; 1577aa,177 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC041628 Gene Symbol: DNMBP Gene ID (NCBI): 23268 RRID: AB_2230665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6XZF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.