Proteintech, 17209-1-AP, CEACAM21 Polyclonal antibody

Size: 20ul / 150ul The CEACAM21 (17209-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM21 in WB, IHC, ELISA applications with reactivity to human, mouse samples 17209-1-AP targets CEACAM21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Carcinoembryonic antigen-related cell adhesion molecule 21 (CEACAM21) is a member of the CEACAM family that has diverse functions in cell adhesion, in intracellular and intercellular signaling, and during complex biological processes such as cancer progression, inflammation, angiogenesis, and metastasis (PMID: 23903773; 32488569). CEACAM21 acts as a heterophilic ligand for TIM-3, leading to the dissociation of Bat3 and increasing proximal TCR signaling and proapoptotic protein expression in late effector T cells, thereby mediating T cell suppression (PMID: 38490257). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10992 Product name: Recombinant human CEACAM21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC012001 Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 21 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012001 Gene Symbol: CEACAM21 Gene ID (NCBI): 90273 RRID: AB_2077481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3KPI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.