Iright
BRAND / VENDOR: Proteintech

Proteintech, 17213-1-AP, MRPL50 Polyclonal antibody

CATALOG NUMBER: 17213-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPL50 (17213-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL50 in WB, IHC, ELISA applications with reactivity to human samples 17213-1-AP targets MRPL50 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1080 cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MRPL50, also named as L50mt, is a mitochondrial protein with MW 18 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10996 Product name: Recombinant human MRPL50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC032008 Sequence: MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVFDFYNVPIQDRSKFDELSASNLPPNLKITWSY Predict reactive species Full Name: mitochondrial ribosomal protein L50 Calculated Molecular Weight: 158 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC032008 Gene Symbol: MRPL50 Gene ID (NCBI): 54534 RRID: AB_2935441 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5N7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924