Iright
BRAND / VENDOR: Proteintech

Proteintech, 17215-1-AP, NLRX1 Polyclonal antibody

CATALOG NUMBER: 17215-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NLRX1 (17215-1-AP) by Proteintech is a Polyclonal antibody targeting NLRX1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 17215-1-AP targets NLRX1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, mouse skeletal muscle tissue, MCF-7 cells, HeLa cells, mouse colon tissue, mouse heart tissue, THP-1 cells, rat colon tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human heart tissue, human liver tissue, mouse heart tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information NLRX1 (Nucleotide-binding oligomerization domain, leucine-rich repeat containing X1) is a member of the NOD-like receptor (NLR) family and is unique among NLRs due to its localization to the mitochondrial matrix. NLRX1 is a negative regulator of innate immunity, particularly in viral infections. It interacts with the mitochondrial antiviral signaling protein (MAVS) to attenuate antiviral responses. NLRX1 has been implicated in various diseases, including multiple sclerosis, colorectal cancer, and ischemia-reperfusion injury. Its role in controlling inflammation and mitochondrial function makes it a potential therapeutic target. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11000 Product name: Recombinant human NLRX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 359-708 aa of BC013199 Sequence: EAVAQAMVLEMFREEDYYNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTEAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLQGVAIQMCWKLPLLPYAHLWTPRMPSHWCFLLILMPPLPQWYDGLVAPRGRCT Predict reactive species Full Name: NLR family member X1 Calculated Molecular Weight: 975 aa, 108 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC013199 Gene Symbol: NLRX1 Gene ID (NCBI): 79671 RRID: AB_2236031 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924