Proteintech, 17220-1-AP, RBM11 Polyclonal antibody

Size: 20ul / 150ul The RBM11 (17220-1-AP) by Proteintech is a Polyclonal antibody targeting RBM11 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 17220-1-AP targets RBM11 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11040 Product name: Recombinant human RBM11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC030196 Sequence: MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY Predict reactive species Full Name: RNA binding motif protein 11 Calculated Molecular Weight: 281 aa, 32 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC030196 Gene Symbol: RBM11 Gene ID (NCBI): 54033 RRID: AB_2175729 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57052 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.