Iright
BRAND / VENDOR: Proteintech

Proteintech, 17230-1-AP, TLR9 Polyclonal antibody

CATALOG NUMBER: 17230-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TLR9 (17230-1-AP) by Proteintech is a Polyclonal antibody targeting TLR9 in IP, ELISA applications with reactivity to human samples 17230-1-AP targets TLR9 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Raji cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TLR9, also known as CD289, is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents and mediate the production of cytokines necessary for the development of effective immunity. TLR9 is a nucleotide-sensing TLR that is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides (PMID:14716310). Upon CpG stimulation, it induces B-cell proliferation, activation, survival, and antibody production (PMID:23857366). TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion, and the inflammatory response (PMID:11564765, 17932028). Specification Tested Reactivity: human Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11071 Product name: Recombinant human TLR9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-353 aa of BC032713 Sequence: FLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAH Predict reactive species Full Name: toll-like receptor 9 Calculated Molecular Weight: 1032 aa, 116 kDa Observed Molecular Weight: 120 kDa, 60 kDa GenBank Accession Number: BC032713 Gene Symbol: TLR9 Gene ID (NCBI): 54106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924