Proteintech, 17243-1-AP, CORO6 Polyclonal antibody

Size: 20ul / 150ul The CORO6 (17243-1-AP) by Proteintech is a Polyclonal antibody targeting CORO6 in WB, ELISA applications with reactivity to human, mouse, rat samples 17243-1-AP targets CORO6 in WB, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11167 Product name: Recombinant human CORO6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC064514 Sequence: MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD Predict reactive species Full Name: coronin 6 Calculated Molecular Weight: 237aa,27 kDa; 286aa,32 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC064514 Gene Symbol: CORO6 Gene ID (NCBI): 84940 RRID: AB_2878368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6QEF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.