Iright
BRAND / VENDOR: Proteintech

Proteintech, 17243-1-AP, CORO6 Polyclonal antibody

CATALOG NUMBER: 17243-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CORO6 (17243-1-AP) by Proteintech is a Polyclonal antibody targeting CORO6 in WB, ELISA applications with reactivity to human, mouse, rat samples 17243-1-AP targets CORO6 in WB, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11167 Product name: Recombinant human CORO6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC064514 Sequence: MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD Predict reactive species Full Name: coronin 6 Calculated Molecular Weight: 237aa,27 kDa; 286aa,32 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC064514 Gene Symbol: CORO6 Gene ID (NCBI): 84940 RRID: AB_2878368 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6QEF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924