Iright
BRAND / VENDOR: Proteintech

Proteintech, 17247-1-AP, ATPB Polyclonal antibody

CATALOG NUMBER: 17247-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATPB (17247-1-AP) by Proteintech is a Polyclonal antibody targeting ATPB in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17247-1-AP targets ATPB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HT-29 cells, HepG2 cells, mouse brain tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ATP5B, also named as ATPMB and ATPSB, belongs to the ATPase alpha/beta chains family. It is a high affinity HDL receptor for apolipoprotein A1. ATP5B is a subunit of mitochondrial ATP synthase (F1F0 ATP synthase or Complex V ). ATP5B has a calculated molecular mass of 57 kDa and ~5 kDa transit peptide can be removed in the mature form. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11177 Product name: Recombinant human ATPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-529 aa of BC016512 Sequence: EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide Calculated Molecular Weight: 529 aa, 57 kDa Observed Molecular Weight: 45-57 kDa GenBank Accession Number: BC016512 Gene Symbol: ATPB Gene ID (NCBI): 506 RRID: AB_2061878 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06576 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924