Proteintech, 17251-1-AP, COL8A1 Polyclonal antibody

Size: 20ul / 150ul The COL8A1 (17251-1-AP) by Proteintech is a Polyclonal antibody targeting COL8A1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17251-1-AP targets COL8A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, HepG2 cells, COLO 320 cells, mouse kidney tissue, mouse spleen tissue, rat kidney tissue Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10607 Product name: Recombinant human COL8A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 396-744 aa of BC013581 Sequence: GIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM Predict reactive species Full Name: collagen, type VIII, alpha 1 Calculated Molecular Weight: 744 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC013581 Gene Symbol: COL8A1 Gene ID (NCBI): 1295 RRID: AB_10696173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27658 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.