Iright
BRAND / VENDOR: Proteintech

Proteintech, 17271-1-AP, GSTA4 Polyclonal antibody

CATALOG NUMBER: 17271-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTA4 (17271-1-AP) by Proteintech is a Polyclonal antibody targeting GSTA4 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 17271-1-AP targets GSTA4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Positive IP detected in: SH-SY5Y cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GSTA4 (Glutathione S-Transferase Alpha 4) is an enzyme that plays a key role in detoxification and antioxidant defense. Its structure includes a GSH-binding site and a hydrophobic substrate-binding domain, functioning as a dimer. Dysregulation of GSTA4 is linked to diseases like cancer, neurodegeneration, and diabetes. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11028 Product name: Recombinant human GSTA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC015523 Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP Predict reactive species Full Name: glutathione S-transferase alpha 4 Calculated Molecular Weight: 222 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC015523 Gene Symbol: GSTA4 Gene ID (NCBI): 2941 RRID: AB_2295133 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15217 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924