Iright
BRAND / VENDOR: Proteintech

Proteintech, 17278-1-AP, UBE2L6 Polyclonal antibody

CATALOG NUMBER: 17278-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2L6 (17278-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2L6 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 17278-1-AP targets UBE2L6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: Jurkat cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11045 Product name: Recombinant human UBE2L6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC032491 Sequence: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS Predict reactive species Full Name: ubiquitin-conjugating enzyme E2L 6 Calculated Molecular Weight: 153 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC032491 Gene Symbol: UBE2L6 Gene ID (NCBI): 9246 RRID: AB_2211001 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924