Iright
BRAND / VENDOR: Proteintech

Proteintech, 17305-1-AP, ENPP4 Polyclonal antibody

CATALOG NUMBER: 17305-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ENPP4 (17305-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17305-1-AP targets ENPP4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ENPP4, also named as KIAA0879 or NPP4, is a 453 amino acid protein, which belongs to the nucleotide pyrophosphatase/phosphodiesterase family. ENPP4 localizes in the cell membrane and hydrolyzes extracellular Ap3A into AMP and ADP, and Ap4A into AMP and ATP. ENPP4 is expressed on the surface of vascular endothelia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11192 Product name: Recombinant human ENPP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-350 aa of BC018054 Sequence: LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLA Predict reactive species Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative function) Calculated Molecular Weight: 453 aa, 52 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC018054 Gene Symbol: ENPP4 Gene ID (NCBI): 22875 RRID: AB_2099780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6X5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924