Iright
BRAND / VENDOR: Proteintech

Proteintech, 17315-1-AP, HLA-DQB2 Polyclonal antibody

CATALOG NUMBER: 17315-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HLA-DQB2 (17315-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DQB2 in WB, ELISA applications with reactivity to human, mouse, rat samples 17315-1-AP targets HLA-DQB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, HepG2 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11284 Product name: Recombinant human HLA-DQB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-231 aa of BC031995 Sequence: MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH Predict reactive species Full Name: major histocompatibility complex, class II, DQ beta 2 Calculated Molecular Weight: 231aa,27 kDa; 275aa,31 kDa Observed Molecular Weight: 27 kDa, 31 kDa GenBank Accession Number: BC031995 Gene Symbol: HLA-DQB2 Gene ID (NCBI): 3120 RRID: AB_1939611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05538 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924