Proteintech, 17318-1-AP, NUDT18 Polyclonal antibody

Size: 20ul / 150ul The NUDT18 (17318-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT18 in IF/ICC, IP, ELISA applications with reactivity to human samples 17318-1-AP targets NUDT18 in IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information 8-oxo-dGDP phosphatase NUDT18, also known as MTH3, belongs to the Nudix hydrolase family that eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of various nucleotide substrates, cofactors, and signaling molecules (PMID: 35732208, 22556419). NUDT18 is specifically active against 8-oxo-dGDP and hardly cleaves 8-oxo-dGTP. NUDT18 is markedly elevated expression in noncancerous cell lines in comparison to cancerous counterpart, and NUDT18 deficient cells have been reported to exhibit a noticeably reduced proliferation rate (PMID: 38944687). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11292 Product name: Recombinant human NUDT18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC016902 Sequence: MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILPQELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVTACGLDPMEQRGGMKMAVLRLLQECLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVMEEDLQSQLLQRLQGSSVVPVNR Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 18 Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC016902 Gene Symbol: NUDT18 Gene ID (NCBI): 79873 RRID: AB_3669267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZVK8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.