Iright
BRAND / VENDOR: Proteintech

Proteintech, 17336-1-AP, CD1d Polyclonal antibody

CATALOG NUMBER: 17336-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD1d (17336-1-AP) by Proteintech is a Polyclonal antibody targeting CD1d in WB, ELISA applications with reactivity to human, mouse samples 17336-1-AP targets CD1d in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skin tissue, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CD1d is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. CD1d is an antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on NKT cells. When activated, NKT cells rapidly produce Th1 and Th2 cytokines. The molecular weight of unglycosylated CD1d is 38 kDa, while glycosylated form of CD1d is 48-50 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11371 Product name: Recombinant human CD1D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-302 aa of BC027926 Sequence: SAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSM Predict reactive species Full Name: CD1d molecule Calculated Molecular Weight: 335 aa, 38 kDa Observed Molecular Weight: 38-40 kDa, 50-55 kDa GenBank Accession Number: BC027926 Gene Symbol: CD1d Gene ID (NCBI): 912 RRID: AB_2878387 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924