Iright
BRAND / VENDOR: Proteintech

Proteintech, 17343-1-AP, PLAC1L Polyclonal antibody

CATALOG NUMBER: 17343-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLAC1L (17343-1-AP) by Proteintech is a Polyclonal antibody targeting PLAC1L in WB, IHC, ELISA applications with reactivity to human samples 17343-1-AP targets PLAC1L in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLAC1L, also named as TMEM122, is placenta specific protein. It is trophoblastic giant cells stain. The MW of PLAC1L is 16-18 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11384 Product name: Recombinant human PLAC1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC036256 Sequence: MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIADFQTTAEELGLLSSSPNLL Predict reactive species Full Name: placenta-specific 1-like Calculated Molecular Weight: 158 aa, 18 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC036256 Gene Symbol: PLAC1L Gene ID (NCBI): 219990 RRID: AB_2878391 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924