Iright
BRAND / VENDOR: Proteintech

Proteintech, 17346-1-AP, C1r Polyclonal antibody

CATALOG NUMBER: 17346-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C1r (17346-1-AP) by Proteintech is a Polyclonal antibody targeting C1r in WB, IHC, ELISA applications with reactivity to human samples 17346-1-AP targets C1r in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human blood Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The first component of complement is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. The serine protease subunits C1r and C1s form a Ca(2+)-dependent C1s-C1r-C1r-C1s tetramer. C1r acts by transforming the activation signal into an enzymic activity. C1r is a single-chain glycoprotein that can be cleaved into an A chain and a B chain upon activation. This antibody recognizes the full-length C1r chain and the cleaved B chain. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11390 Product name: Recombinant human C1R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-705 aa of BC035220 Sequence: AVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED Predict reactive species Full Name: complement component 1, r subcomponent Calculated Molecular Weight: 705 aa, 80 kDa Observed Molecular Weight: 85 kDa, 30 kDa GenBank Accession Number: BC035220 Gene Symbol: C1R Gene ID (NCBI): 715 RRID: AB_2878392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924