Proteintech, 17355-1-AP, ACTL7A Polyclonal antibody

Size: 20ul / 150ul The ACTL7A (17355-1-AP) by Proteintech is a Polyclonal antibody targeting ACTL7A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17355-1-AP targets ACTL7A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ACTL7a is located in the acrosome and tail of mature spermatozoa and plays an important role in spermiogenesis. Recently mutation of ACTL7A has been linked to infertility. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10613 Product name: Recombinant human ACTL7A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-280 aa of BC014610 Sequence: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC Predict reactive species Full Name: actin-like 7A Calculated Molecular Weight: 435 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC014610 Gene Symbol: ACTL7A Gene ID (NCBI): 10881 RRID: AB_2273677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y615 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.