Iright
BRAND / VENDOR: Proteintech

Proteintech, 17356-1-AP, CHDH Polyclonal antibody

CATALOG NUMBER: 17356-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHDH (17356-1-AP) by Proteintech is a Polyclonal antibody targeting CHDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17356-1-AP targets CHDH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse kidney tissue, mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CHDH(Choline dehydrogenase, mitochondrial) is also named as CDH,CHD and belongs to the GMC oxidoreductase family. CHDH is a member of the glucose-methanol-choline family of oxidoreductases, with each member containing a consensus FAD-binding domain. Many members of this oxidoreductase family are soluble proteins but mammalian CHDH is associated with the inner mitochondrial membrane(Handbook of vitamins,Robert B,2007). The full length protein(65 kDa) has a transit peptide of 29 amino acid and the mature CHDH is appropriately located in the inner mitochondria membrane(PMID:12951056). 17356-1-AP can also recognize the 45 kDa isoform X3 of CHDH. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10614 Product name: Recombinant human CHDH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 244-594 aa of BC034502 Sequence: YLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR Predict reactive species Full Name: choline dehydrogenase Calculated Molecular Weight: 594 aa, 65 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC034502 Gene Symbol: CHDH Gene ID (NCBI): 55349 RRID: AB_2276253 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NE62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924