Proteintech, 17357-1-AP, SPATA16 Polyclonal antibody

Size: 20ul / 150ul The SPATA16 (17357-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA16 in IHC, ELISA applications with reactivity to human samples 17357-1-AP targets SPATA16 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SPATA16, also named as NYD-SP12, belongs to the SPATA16 family. It is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. SPATA16 localizes to Golgi apparatus and is primarily expressed in testis, with lower levels found in kidney and pancreas. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10637 Product name: Recombinant human SPATA16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 221-570 aa of BC034496 Sequence: EDIASVASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAYFRNHLRQATVFRCLERYSEAARSAMIADYMFWLGGGREESISKLIKLYWQAMIEEAITRAESFSVMYTPFATKIRADKIEKVKDAFTKTHPAYAEYMYTDLQALHMLPQTVDWSSFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEHKTPFGLTREDTVRQMETMGKRILPILDFIRSTQLNGSFPASSGVMEKLQYASLLSQLQRVKEQSQVINQAMAELATIPYLQDISQQEAELLQSLMADAMDTLEGRRNNNERVWNMIQKVGQIEDFLYQLEDSFLKTKKLRTARRQKTKMKRLQTVQQR Predict reactive species Full Name: spermatogenesis associated 16 Calculated Molecular Weight: 569 aa, 65 kDa GenBank Accession Number: BC034496 Gene Symbol: SPATA16 Gene ID (NCBI): 83893 RRID: AB_2878396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.