Proteintech, 17367-1-AP, TADA2B Polyclonal antibody

Size: 20ul / 150ul The TADA2B (17367-1-AP) by Proteintech is a Polyclonal antibody targeting TADA2B in WB, IHC, ELISA applications with reactivity to human samples 17367-1-AP targets TADA2B in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, MCF-7 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10783 Product name: Recombinant human TADA2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 215-420 aa of BC013164 Sequence: ERQRRKNIARDYNLVPAFLGKDKKEKEKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAARHKREKRKENKNLAGSKRGKEDGKDSEFAAIENLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS Predict reactive species Full Name: transcriptional adaptor 2 (ADA2 homolog, yeast)-beta Calculated Molecular Weight: 420 aa, 48 kDa Observed Molecular Weight: 55-62 kDa GenBank Accession Number: BC013164 Gene Symbol: TADA2B Gene ID (NCBI): 93624 RRID: AB_2201049 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86TJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.