Iright
BRAND / VENDOR: Proteintech

Proteintech, 17390-1-AP, ALDH1L1 Polyclonal antibody

CATALOG NUMBER: 17390-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALDH1L1 (17390-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1L1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 17390-1-AP targets ALDH1L1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse liver, rat liver Positive IP detected in: mouse liver tissue Positive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Aldehyde dehydrogenase 1 family member L1 (ALDH1L1), belongs to the aldehyde dehydrogenase family of proteins and is responsible for formate oxidation in vivo. Loss of ALDH1L1 is associated with decreased apoptosis, increased cell motility, and cancer progression. ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 has some isoforms with MW of 99, 88 and 55 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11285 Product name: Recombinant human ALDH1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-505 aa of BC027241 Sequence: DDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMYRAPPSPSTRPDPTAT Predict reactive species Full Name: aldehyde dehydrogenase 1 family, member L1 Calculated Molecular Weight: 99 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC027241 Gene Symbol: ALDH1L1 Gene ID (NCBI): 10840 RRID: AB_2878401 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924