Iright
BRAND / VENDOR: Proteintech

Proteintech, 17400-1-AP, FGF1 Polyclonal antibody

CATALOG NUMBER: 17400-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FGF1 (17400-1-AP) by Proteintech is a Polyclonal antibody targeting FGF1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17400-1-AP targets FGF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse spinal cord tissue, mouse heart tissue, rat heart tissue, rat brain tissue Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11366 Product name: Recombinant human FGF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC032697 Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Predict reactive species Full Name: fibroblast growth factor 1 (acidic) Calculated Molecular Weight: 155 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC032697 Gene Symbol: FGF1 Gene ID (NCBI): 2246 RRID: AB_2103758 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05230 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924