Iright
BRAND / VENDOR: Proteintech

Proteintech, 17422-1-AP, KIF26B Polyclonal antibody

CATALOG NUMBER: 17422-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIF26B (17422-1-AP) by Proteintech is a Polyclonal antibody targeting KIF26B in WB, IHC, ELISA applications with reactivity to human, canine samples 17422-1-AP targets KIF26B in WB, IHC, IF, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: MDCK cells, HEK-293 cells, MCF-7 cells Positive IHC detected in: human kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information KIF26B is a member of kinesin-11 family and plays important role in embryogenesis. It is a downstram target of Sall1 and is essential for kidney development. KIF26B is also involved in tumorigenesis. Specification Tested Reactivity: human, canine Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11446 Product name: Recombinant human KIF26B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-355 aa of BC042481 Sequence: AFSAVIHDKLQVPNTIRKAWNDRDNRCDICATHLNQLKQEAIQMVLTLEQAAGSEHYDASPCSPPPLSNIPTLVGSRHVGGLQQPRDWAFVPAPCATSNYTGFANKHGSKPSSLGVSNGAEKKSGSPTHQAKVSLQMATSPSNGNILNSVAIQAHQYLDGTWSLSRTNGVTLYPYQDSEALVTRGRGRLEDSAAAPALMSEDRGA Predict reactive species Full Name: kinesin family member 26B Calculated Molecular Weight: 2108aa,224 kDa; 162aa,17 kDa Observed Molecular Weight: 224-230 kDa GenBank Accession Number: BC042481 Gene Symbol: KIF26B Gene ID (NCBI): 55083 RRID: AB_2131762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2KJY2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924