Iright
BRAND / VENDOR: Proteintech

Proteintech, 17430-1-AP, MAGT1 Polyclonal antibody

CATALOG NUMBER: 17430-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAGT1 (17430-1-AP) by Proteintech is a Polyclonal antibody targeting MAGT1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 17430-1-AP targets MAGT1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, COLO 320 cells, HEK-293 cells, mouse colon tissue, mouse heart tissue, rat cerebellum tissue Positive IHC detected in: human colon cancer tissue, human liver tissue, human skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: C2C12 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients'cells by western blot or immunofluorescent cell surface staining. MAGT1 had been detected as 38 kDa (PMID: 18705540) or 45-47 kDa (PMID: 27383987) by western blot. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11496 Product name: Recombinant human MAGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-182 aa of BC060842 Sequence: KKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIR Predict reactive species Full Name: magnesium transporter 1 Calculated Molecular Weight: 335 aa, 38 kDa Observed Molecular Weight: 45-47 kDa GenBank Accession Number: BC060842 Gene Symbol: MAGT1 Gene ID (NCBI): 84061 RRID: AB_2138982 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0U3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924