Iright
BRAND / VENDOR: Proteintech

Proteintech, 17451-1-AP, Serpin A12/Vaspin Polyclonal antibody

CATALOG NUMBER: 17451-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Serpin A12/Vaspin (17451-1-AP) by Proteintech is a Polyclonal antibody targeting Serpin A12/Vaspin in WB, ELISA applications with reactivity to human samples 17451-1-AP targets Serpin A12/Vaspin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human adipose tissue, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327). Specification Tested Reactivity: human Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11574 Product name: Recombinant human SERPINA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-414 aa of BC040857 Sequence: MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK Predict reactive species Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 Calculated Molecular Weight: 414 aa, 47 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: BC040857 Gene Symbol: Vaspin Gene ID (NCBI): 145264 RRID: AB_2878408 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IW75 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924