Iright
BRAND / VENDOR: Proteintech

Proteintech, 17458-1-AP, RTKN2 Polyclonal antibody

CATALOG NUMBER: 17458-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RTKN2 (17458-1-AP) by Proteintech is a Polyclonal antibody targeting RTKN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17458-1-AP targets RTKN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HEK-293 cells, mouse lymph tissue Positive IHC detected in: human placenta tissue, human brain tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11098 Product name: Recombinant human RTKN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC025765 Sequence: MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMREGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTSELQKLEEQIANQTGRCDVKFESKERTACKGKIAISDIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANVFDTDVVNVDKTITDICFENVTIL Predict reactive species Full Name: rhotekin 2 Calculated Molecular Weight: 163aa,19 kDa; 609aa,69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC025765 Gene Symbol: RTKN2 Gene ID (NCBI): 219790 RRID: AB_2034939 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924