Proteintech, 17508-1-AP, NUDT3/4/10/11 Polyclonal antibody

Size: 20ul / 150ul The NUDT3/4/10/11 (17508-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT3/4/10/11 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17508-1-AP targets NUDT3/4/10/11 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NUDT10 (nucleoside diphosphate linked moiety X-type motif 10), also named as DIPP3A or APS2, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). This antibody can recognize all the 5 isoforms of DIPP (NUDT3/4/10/11). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11711 Product name: Recombinant human NUDT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC050700 Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 10 Calculated Molecular Weight: 164 aa, 19 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC050700 Gene Symbol: NUDT10 Gene ID (NCBI): 170685 RRID: AB_2154145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.