Proteintech, 17581-1-AP, HRASLS5 Polyclonal antibody

Size: 20ul / 150ul The HRASLS5 (17581-1-AP) by Proteintech is a Polyclonal antibody targeting HRASLS5 in IHC, ELISA applications with reactivity to human samples 17581-1-AP targets HRASLS5 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissue, human heart tissue, human ovary tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11113 Product name: Recombinant human HRASLS5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-269 aa of BC034222 Sequence: MGLSPGAEGEYALRLPRIPPPLPKPASRTAGTGPKDQPPALRRSAVPHSEESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA Predict reactive species Full Name: HRAS-like suppressor family, member 5 Calculated Molecular Weight: 269 aa, 29 kDa GenBank Accession Number: BC034222 Gene Symbol: HRASLS5 Gene ID (NCBI): 117245 RRID: AB_2233327 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.