Iright
BRAND / VENDOR: Proteintech

Proteintech, 17600-1-AP, MTMR15/FAN1 Polyclonal antibody

CATALOG NUMBER: 17600-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTMR15/FAN1 (17600-1-AP) by Proteintech is a Polyclonal antibody targeting MTMR15/FAN1 in WB, IP, ELISA applications with reactivity to human samples 17600-1-AP targets MTMR15/FAN1 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human spleen tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information MTMR15, also named as FAN1 and KIAA1018, is a nuclease required for the repair of DNA interstrand cross-links (ICL) recruited at sites of DNA damage by monoubiquitinated FANCD2. It is specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, probably in the resolution of homologous recombination intermediates. MTMR15 has some isoforms with MW 114 kDa and 60 kDa. The MW will be migrated to 120-140 kDa and 63-68 kDa with modification. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11651 Product name: Recombinant human MTMR15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-534 aa of BC047882 Sequence: STVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRESKIMEAESQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACHCEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQGSSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVRLFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSLAKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRFCWLLLQ Predict reactive species Full Name: myotubularin related protein 15 Calculated Molecular Weight: 60 kDa, 114 kDa Observed Molecular Weight: 63-68 kDa, 120-140 kDa GenBank Accession Number: BC047882 Gene Symbol: MTMR15 Gene ID (NCBI): 22909 RRID: AB_10598016 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924