Iright
BRAND / VENDOR: Proteintech

Proteintech, 17607-1-AP, SLC39A9 Polyclonal antibody

CATALOG NUMBER: 17607-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC39A9 (17607-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A9 in WB, IHC, ELISA applications with reactivity to human samples 17607-1-AP targets SLC39A9 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Zinc transporter ZIP9 subfamily (SLC39A9) encodes a protein with characteristics of a membrane androgen receptor (mAR). Human ZIP9 is a 307-amino acid protein, which has eight putative transmembrane domains. ZIP9 has also been identified and characterized as a resident protein in the Golgi in DT40 and HeLa cell lines (PMID: 19420709, 23505453). ZIP9 may be present on the cell surface, as well as nuclear and mitochondrial membranes, in human breast and prostate cancer cell lines, where it mediates testosterone induction of apoptosis (PMID: 29952128). knockout of ZIP9 would lead to zinc accumulation in the secretory pathway, which could influence the general ion homeostasis and in turn the glycosylation outcome (PMID: 36648436). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11752 Product name: Recombinant human SLC39A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC047682 Sequence: MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNS Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 9 Calculated Molecular Weight: 307 aa, 32 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC047682 Gene Symbol: SLC39A9 Gene ID (NCBI): 55334 RRID: AB_3085528 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924