Iright
BRAND / VENDOR: Proteintech

Proteintech, 17661-1-AP, MFAP4 Polyclonal antibody

CATALOG NUMBER: 17661-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul MFAP4 Polyclonal Antibody for WB, IHC, ELISA 17661-1-AP targets MFAP4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, mouse heart tissue, mouse lung tissue, rat lung tissue Positive IHC detected in: human lung tissue, human placenta tissue, human testis tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Microfibrillar-associated protein 4 (MFAP4) is a extracellular matrix glycoprotein containing a fibrinogen C-terminal domain and a N-terminal located integrin-binding motif. It could be involved in calcium-dependent cell adhesion or intercellular interactions. MFAP4 gene is commonly deleted in Smith-Magenis syndrome patients. (PMID: 7633408; 16867155; 10542261; 18322703) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11920 Product name: Recombinant human MFAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC062415 Sequence: MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA Predict reactive species Full Name: microfibrillar-associated protein 4 Calculated Molecular Weight: 255 aa, 29 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC062415 Gene Symbol: MFAP4 Gene ID (NCBI): 4239 RRID: AB_2142355 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55083 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924