Proteintech, 17671-1-AP, UTP6 Polyclonal antibody

Size: 20ul / 150ul The UTP6 (17671-1-AP) by Proteintech is a Polyclonal antibody targeting UTP6 in WB, ELISA applications with reactivity to human, mouse, rat samples 17671-1-AP targets UTP6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11327 Product name: Recombinant human UTP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-335 aa of BC035325 Sequence: MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIRRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAVEVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLE Predict reactive species Full Name: UTP6, small subunit (SSU) processome component, homolog (yeast) Calculated Molecular Weight: 597 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC035325 Gene Symbol: UTP6 Gene ID (NCBI): 55813 RRID: AB_2214465 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.