Proteintech, 17679-1-AP, MRPL55 Polyclonal antibody

Size: 20ul / 150ul The MRPL55 (17679-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL55 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17679-1-AP targets MRPL55 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MRPL55, also named as L55mt and MRP-L55, is a component of the mitochondrial ribosome large subunit (39S). It acts dynamically in the cell during development. The MW of MRPL55 is about 13 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11716 Product name: Recombinant human MRPL55 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC052806 Sequence: MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK Predict reactive species Full Name: mitochondrial ribosomal protein L55 Calculated Molecular Weight: 128 aa, 15 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC052806 Gene Symbol: MRPL55 Gene ID (NCBI): 128308 RRID: AB_2878427 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7F7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.