Iright
BRAND / VENDOR: Proteintech

Proteintech, 17747-1-AP, GRAF Polyclonal antibody

CATALOG NUMBER: 17747-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GRAF (17747-1-AP) by Proteintech is a Polyclonal antibody targeting GRAF in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17747-1-AP targets GRAF in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, human brain tissue, mouse thymus tissue Positive IP detected in: HepG2 cells Positive IHC detected in: mouse brain tissue, human heart tissue, human liver tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GTPase Regulator Associated with Focal Adhesion Kinase (GRAF), also known as Rho GTPase activating protein 26 (ARHGAP26) , is a GTPase-activating protein and inhibits the activity of Rho GTPases by promoting the hydrolytic ability of Rho GTPases. GRAF enhances the hydrolysis of GTPases and converts GTPases from an active form to an inactive form, thereby inhibiting signaling transduction. Deletion and mutation of GRAF can lead to promyelocytic leukemia, suggesting tumor suppressive activity of GRAF. GRAF was downregulated in glioblastoma and associated with cell proliferation and migration (PMID: 10908648, PMID: 17611651, PMID: 31004081). It has been reported that there are three splicing mutants of GRAF, namely GRAF1a (92 kDa),GRAF1b (86 kDa) and GRAF1c (75-82 kDa), and GRAF1b and GRAF1c are the major GRAF1 isoforms in adult brain, whereas GRAF1a is abundant in neonates(PMID: 35624318, PMID: 30626696). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12008 Product name: Recombinant human ARHGAP26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 403-759 aa of BC068555 Sequence: RGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL Predict reactive species Full Name: Rho GTPase activating protein 26 Calculated Molecular Weight: 759 aa, 86 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC068555 Gene Symbol: ARHGAP26 Gene ID (NCBI): 23092 RRID: AB_2059284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924