Iright
BRAND / VENDOR: Proteintech

Proteintech, 17759-1-AP, CNDP1 Polyclonal antibody

CATALOG NUMBER: 17759-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNDP1 (17759-1-AP) by Proteintech is a Polyclonal antibody targeting CNDP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17759-1-AP targets CNDP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells Positive IHC detected in: human prostate cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Beta-Ala-His dipeptidase (CNDP1) encodes the secreted serum carnosinase, which is synthesized in the brain and secreted into the systematic circulation, CNDP1 hydrolyzes L-carnosine and is essential for glucose metabolism and the transportation of activated fatty acids across the mitochondrial membrane (PMID: 32111749, 16046297). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12127 Product name: Recombinant human CNDP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-508 aa of BC110295 Sequence: YGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILNEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH Predict reactive species Full Name: carnosine dipeptidase 1 (metallopeptidase M20 family) Calculated Molecular Weight: 508 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC110295 Gene Symbol: CNDP1 Gene ID (NCBI): 84735 RRID: AB_2878435 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96KN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924