Iright
BRAND / VENDOR: Proteintech

Proteintech, 17785-1-AP, Synaptophysin Polyclonal antibody

CATALOG NUMBER: 17785-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Synaptophysin (17785-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptophysin in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 17785-1-AP targets Synaptophysin in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, PC-12 cells, SH-SY5Y cells, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse pancreas tissue, mouse brain tissue, human brain tissue, ganglioma tissue, human pancreas tissue, neuroblastoma tissue, human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue, human lung cancer tissue, human gliomas tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for the identification of neuroendocrine cells and neoplasms. Synaptic proteins, including synaptophysin, are reduced in brain tissue from patients with Alzheimer's disease. (PMID: 3010302; 21658579) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine, zebrafish, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11781 Product name: Recombinant human Synaptophysin; SYP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-313 aa of BC064550 Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Predict reactive species Full Name: synaptophysin Calculated Molecular Weight: 313 aa, 34 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC064550 Gene Symbol: Synaptophysin Gene ID (NCBI): 6855 RRID: AB_2271365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08247 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924