Proteintech, 17792-1-AP, NOMO1 Polyclonal antibody

Size: 20ul / 150ul The NOMO1 (17792-1-AP) by Proteintech is a Polyclonal antibody targeting NOMO1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 17792-1-AP targets NOMO1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue, A431 cells, COLO 320 cells, human brain tissue Positive IP detected in: A431 cells Positive IHC detected in: human colon cancer tissue, human colon tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11895 Product name: Recombinant human NOMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 873-1222 aa of BC065535 Sequence: YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRVLGQAASDNSGPEDAKRQAKKQKTRRT Predict reactive species Full Name: NODAL modulator 1 Calculated Molecular Weight: 1222 aa, 134 kDa Observed Molecular Weight: 135 kDa GenBank Accession Number: BC065535 Gene Symbol: NOMO1 Gene ID (NCBI): 23420 RRID: AB_2152031 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15155 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.