Proteintech, 17798-1-AP, GORAB Polyclonal antibody

Size: 20ul / 150ul The GORAB (17798-1-AP) by Proteintech is a Polyclonal antibody targeting GORAB in WB, ELISA applications with reactivity to human, mouse samples 17798-1-AP targets GORAB in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse lung tissue, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information GORAB, also known as Scyl1BP1, is a protein that localizes to the trans-side of the Golgi apparatus and plays a significant role in intracellular trafficking and protein glycosylation. It is composed of a central coiled-coil region that is responsible for Golgi targeting, likely through interactions with small GTPases Rab6 and Arf5. GORAB is considered a member of the golgin family of coiled-coil Golgi proteins, which are involved in vesicle tethering. GORAB has been implicated in several cellular functions. It has been proposed to function as a transcriptional activator for neurite outgrowth, as a modulator of MDM2 ubiquitylation impacting p53 levels and apoptosis, and has been shown to play a role in centriole duplication and ciliogenesis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12002 Product name: Recombinant human GORAB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC064945 Sequence: MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR Predict reactive species Full Name: golgin, RAB6-interacting Calculated Molecular Weight: 264aa,28 kDa; 394aa,45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC064945 Gene Symbol: GORAB Gene ID (NCBI): 92344 RRID: AB_10755145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T7V8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.