Proteintech, 17814-1-AP, PRPSAP2 Polyclonal antibody

Size: 20ul / 150ul The PRPSAP2 (17814-1-AP) by Proteintech is a Polyclonal antibody targeting PRPSAP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17814-1-AP targets PRPSAP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, mouse brain tissue, HeLa cells, rat brain tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PRPSAP2, also named as PAP41, is 369 amino acid protein, which Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis. PRPSAP2 is another protein involved in nucleic acid metabolism. The PRPSAP2 gene encodes part of the enzyme PRPP synthetase, which catalyzes the formation of phosphoribosylpyrophosphate, being a primary substrate for newly formed purine and pyrimidine nucleotides. Depletion of the PRPP synthetase causes growth arrest], the reverse has not been shown. Overexpression of SHMT1 and PRPSAP2 (and also COPS3) has been reported to occur in multiple myelomas . PRPSAP2 exists several isoforms with the range of molecular weight about 35-43 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12132 Product name: Recombinant human PRPSAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-369 aa of BC106050 Sequence: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD Predict reactive species Full Name: phosphoribosyl pyrophosphate synthetase-associated protein 2 Calculated Molecular Weight: 369 aa, 41 kDa Observed Molecular Weight: 37-41 kDa GenBank Accession Number: BC106050 Gene Symbol: PRPSAP2 Gene ID (NCBI): 5636 RRID: AB_10598314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60256 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.