Proteintech, 17826-1-AP, SPERT Polyclonal antibody

Size: 20ul / 150ul The SPERT (17826-1-AP) by Proteintech is a Polyclonal antibody targeting SPERT in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17826-1-AP targets SPERT in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse spermatophore tissue, PC-3 cells Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SPERT (spermatid associated protein), also known as CBY2 (chibby homolog 2) or NURIT, is a novel leucine-zipper protein belonging to the chibby family of proteins [PMID:12204287]. Uniquely expressed in the spermatid flower-like structure, SPERT interacts with Nek1, a member of the NIMA-family kinase family that is associated centrosomal stability and ciliogenesis. It contains a leucine-zipper motif and two coiled-coil regions, and is transcribed through the elongation stage of the spermatids. SPERT is absent from mature spermatozoa and is thought to be involved in transporting proteins that are to be discarded via the residual bodies. [PMID:12204287] Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12200 Product name: Recombinant human SPERT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-412 aa of BC027609 Sequence: MQPEGLKCRMEESNAERGTAEPFPRLHNLYSTPRCAQQAALPRLSRRMASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHKRLAKECMLQEENKSLREENKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQGSGLSSRFEEPKGPPARQEDSKELRALRKMVSNMSGPSGEEEAKVGPGLPDGCQPLQLLREMRQALQALLKENRLLQEENRTLQVLRAEHRGFQEENKALWENNKLKLQQKLVIDTVTEVTARMEMLIEELYAFMPARSQDPKKPSRV Predict reactive species Full Name: spermatid associated Calculated Molecular Weight: 448 aa, 47 kDa, 52 kDa Observed Molecular Weight: 48-52 kDa GenBank Accession Number: BC027609 Gene Symbol: SPERT Gene ID (NCBI): 220082 RRID: AB_2195674 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.