Iright
BRAND / VENDOR: Proteintech

Proteintech, 17859-1-AP, GCS1 Polyclonal antibody

CATALOG NUMBER: 17859-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GCS1 (17859-1-AP) by Proteintech is a Polyclonal antibody targeting GCS1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 17859-1-AP targets GCS1 in WB, IF, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells Positive IHC detected in: human small intestine tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MOGS (Mannosyl-oligosaccharide glucosidase), also known as GCS1, is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor (PMID: 38187061). The resulting Glc(2)-Man(9)-GlcNAc(2) intermediate is then further modified by glucosidase II and several ER- and Golgi-resident mannosidases and glycosyltransferases, finally yielding a complex array of glycan structures (PMID: 3896128). MOGS has two isoforms, and it is located in the lumen of the endoplasmic reticulum. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12321 Product name: Recombinant human MOGS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 492-837 aa of BC028337 Sequence: DEARARVPPEFLVQRAVHANPPTLLLPVAHMLEVGDPDDLAFLRKALPRLHAWFSWLHQSQAGPLPLSYRWRGRDPALPTLLNPKTLPSGLDDYPRASHPSVTERHLDLRCWVALGARVLTRLAEHLGEAEVAAELGPLAASLEAAESLDELHWAPELGVFADFGNHTKAVQLKPRPPQGLVRVVGRPQPQLQYVDALGYVSLFPLLLRLLDPTSSRLGPLLDILADSRHLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAVWLNVNYLALGALHHYGHLEGPHQARAAKLHGELRANVVGNVWRQYQATGFLWEQYSDRDGRGMGCRPFHGWTSLVLLAMAEDY Predict reactive species Full Name: mannosyl-oligosaccharide glucosidase Calculated Molecular Weight: 837 aa, 92 kDa Observed Molecular Weight: 80-92 kDa GenBank Accession Number: BC028337 Gene Symbol: GCS1 Gene ID (NCBI): 7841 RRID: AB_10694270 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924