Proteintech, 17872-1-AP, TP53INP1 Polyclonal antibody

Size: 20ul / 150ul The TP53INP1 (17872-1-AP) by Proteintech is a Polyclonal antibody targeting TP53INP1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17872-1-AP targets TP53INP1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12358 Product name: Recombinant human TP53INP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC074868 Sequence: MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY Predict reactive species Full Name: tumor protein p53 inducible nuclear protein 1 Calculated Molecular Weight: 240 aa, 27 kDa GenBank Accession Number: BC074868 Gene Symbol: TP53INP1 Gene ID (NCBI): 94241 RRID: AB_2878458 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.