Proteintech, 17873-1-AP, MMP3 Polyclonal antibody

Size: 20ul / 150ul The MMP3 (17873-1-AP) by Proteintech is a Polyclonal antibody targeting MMP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 17873-1-AP targets MMP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A2780 cells, A549 cells, HeLa cells, human skeletal muscle tissue, U-87 MG cells, PC-12 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat, pig, rabbit, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12359 Product name: Recombinant human MMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-477 aa of BC074869 Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC Predict reactive species Full Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase) Calculated Molecular Weight: 477 aa, 54 kDa Observed Molecular Weight: 45-60 kDa GenBank Accession Number: BC074869 Gene Symbol: MMP3 Gene ID (NCBI): 4314 RRID: AB_2146587 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08254 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.