Proteintech, 17879-1-AP, NDUFA11 Polyclonal antibody

Size: 20ul / 150ul The NDUFA11 (17879-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA11 in WB, ELISA applications with reactivity to human samples 17879-1-AP targets NDUFA11 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, RT-4 cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Mitochondrial complex I is assembled from 44 subunits into an L-shaped complex, with a hydrophobic arm embedded in the inner mitochondrial membrane and the other arm protruding into the mitochondrial matrix. NDUFA11 encodes a subunit of the membrane-bound mitochondrial complex I, and functions in assembly, stability, and regulation of the complex. Mutations in NDUFA11 are associated with severe mitochondrial complex I deficiency(PMID: 18306244). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11746 Product name: Recombinant human NDUFA11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-111 aa of BC069045 Sequence: MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIG Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa Calculated Molecular Weight: 141 aa, 15 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC069045 Gene Symbol: NDUFA11 Gene ID (NCBI): 126328 RRID: AB_3669282 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86Y39 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.