Proteintech, 17899-1-AP, ADAMDEC1 Polyclonal antibody

Size: 20ul / 150ul The ADAMDEC1 (17899-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMDEC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 17899-1-AP targets ADAMDEC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells Positive IHC detected in: human colon cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) was first identified as a unique member of the matrix metalloprotease (ADAM) family. ADAMs are increasingly recognized as playing an important role in gut homeostasis and bowel inflammation. ADAMDEC1 is abundantly, and almost exclusively, expressed in the gastrointestinal (GI) tract. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12265 Product name: Recombinant human ADAMDEC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-470 aa of BC074877 Sequence: REIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE Predict reactive species Full Name: ADAM-like, decysin 1 Calculated Molecular Weight: 470 aa, 53 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC074877 Gene Symbol: ADAMDEC1 Gene ID (NCBI): 27299 RRID: AB_2878461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.