Iright
BRAND / VENDOR: Proteintech

Proteintech, 17908-1-AP, EPO/Erythropoietin Polyclonal antibody

CATALOG NUMBER: 17908-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPO/Erythropoietin (17908-1-AP) by Proteintech is a Polyclonal antibody targeting EPO/Erythropoietin in WB, IHC, ELISA applications with reactivity to human, rat samples 17908-1-AP targets EPO/Erythropoietin in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. Erythropoietin (Epo) is a 166 amino acids protein containing three N-glycosylation sites (Asn-24, Asn-38, and Asn-83) and 1 O- glycosylation site (Ser-126) and involved in the regulation of the level of red blood cells. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. Specification Tested Reactivity: human, rat Cited Reactivity: human, rat, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12302 Product name: Recombinant human EPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-193 aa of BC093628 Sequence: VHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Predict reactive species Full Name: erythropoietin Calculated Molecular Weight: 193 aa, 21 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC093628 Gene Symbol: EPO/Erythropoietin Gene ID (NCBI): 2056 RRID: AB_10638147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01588 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924