Iright
BRAND / VENDOR: Proteintech

Proteintech, 17913-1-AP, SEC31A Polyclonal antibody

CATALOG NUMBER: 17913-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SEC31A (17913-1-AP) by Proteintech is a Polyclonal antibody targeting SEC31A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 17913-1-AP targets SEC31A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COPII-coated vesicles mediate anterograde transport from the ER to the Golgi apparatus. COPII is composed of three parts: two coat protein complexes (Sec23/24 complex and Sec13/31 complex) and one small GTP-binding protein, Sar1 (PMID: 9568718). The sec31 subunit of the coat complex has been shown to be essential for vesicle formation and ER-Golgi transport (PMID: 10788476). Two mammalian homologues of yeast sec31p, Sec31A and Sec31B, share about 40% amino acid identity. Sec31A transcripts are ubiquitously and abundantly expressed. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12314 Product name: Recombinant human SEC31A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 758-1106 aa of BC084583 Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV Predict reactive species Full Name: SEC31 homolog A (S. cerevisiae) Calculated Molecular Weight: 1220 aa, 133 kDa Observed Molecular Weight: 118-140 kDa GenBank Accession Number: BC084583 Gene Symbol: SEC31A Gene ID (NCBI): 22872 RRID: AB_2186378 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94979 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924